PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ONIVA08G22610.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family SBP
Protein Properties Length: 418aa    MW: 42422.8 Da    PI: 9.2965
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ONIVA08G22610.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP134.33.8e-42103180178
                      --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
              SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                      +CqvegC adls +k+y+ rhkvC +hskap v+v+gleqrfCqqCsrfh l efD++krsCrrrLa+hnerrr++q+
  ONIVA08G22610.1 103 RCQVEGCGADLSGIKNYYCRHKVCFMHSKAPRVVVAGLEQRFCQQCSRFHLLPEFDQGKRSCRRRLAGHNERRRRPQT 180
                      6**************************************************************************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.103.4E-35100165IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.47101178IPR004333Transcription factor, SBP-box
SuperFamilySSF1036122.49E-40102181IPR004333Transcription factor, SBP-box
PfamPF031104.9E-32104177IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 418 aa     Download sequence    Send to blast
MEMASGGGAA AAAGGGVGGS GGGGGGGDEH RQLHGLKFGK KIYFEDAAAA AGGGGTGSGS  60
GSASAAPPSS SSKAAGGGRG GGGKNKGKGV AAAAPPPPPP PPRCQVEGCG ADLSGIKNYY  120
CRHKVCFMHS KAPRVVVAGL EQRFCQQCSR FHLLPEFDQG KRSCRRRLAG HNERRRRPQT  180
PLASRYGRLA ASVGEEHRRF RSFTLDFSYP RVPSSVRNAW PAIQPGDRIS GGIQWHGNLA  240
PHGHSSAVAG YGANTYSGQG SSSSGPPVFA GPNLPPGGCL AGVGAATDSS CALSLLSTQP  300
WDTTTHSAAA SHNQAAAMST TTSFDGNPVA PSAMAGSYMA PSPWTGSRGH EGGGRSVAHQ  360
LPHEVSLDEV HPGPSHHAHF SGELELALQG NGPAPAPRID PGSGSTFDQT SNTMDWSL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A5e-291041771184squamosa promoter binding protein-like 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
17682GGRGGGG
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1071910.0AK107191.1 Oryza sativa Japonica Group cDNA clone:002-125-A04, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015650813.10.0PREDICTED: squamosa promoter-binding-like protein 14
SwissprotQ7EXZ20.0SPL14_ORYSJ; Squamosa promoter-binding-like protein 14
TrEMBLA0A0E0AXH60.0A0A0E0AXH6_9ORYZ; Uncharacterized protein
TrEMBLA0A0E0IEA90.0A0A0E0IEA9_ORYNI; Uncharacterized protein
STRINGORGLA08G0176500.10.0(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP25273787
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G42200.17e-42squamosa promoter binding protein-like 9